General Information

  • ID:  hor005568
  • Uniprot ID:  Q80T19(59-83)
  • Protein name:  Hepcidin-2
  • Gene name:  Hamp2
  • Organism:  Mus musculus (Mouse)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  Highly expressed in the liver and to a much lesser extent in the heart. Also expressed in pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0097690 iron ion transmembrane transporter inhibitor activity
  • GO BP:  GO:0002092 positive regulation of receptor internalization; GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0010039 response to iron ion; GO:0031640 killing of cells of another organism; GO:0034760 negative regulation of iron ion transmembrane transport; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0050832 defense response to fungus; GO:0060586 multicellular organismal-level iron ion homeostasis; GO:0061051 positive regulation of cell growth involved in cardiac muscle cell development; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:1902916 positive regulation of protein polyubiquitination; GO:1904039 negative regulation of iron export across plasma membrane; GO:1904479 negative regulation of intestinal absorption; GO:2000646 positive regulation of receptor catabolic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0014704 intercalated disc; GO:0045179 apical cortex

Sequence Information

  • Sequence:  DINFPICRFCCQCCNKPSCGICCEE
  • Length:  25(59-83)
  • Propeptide:  MALSTRTQAACLLLLLLASLSSTTYLQQQMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCEE
  • Signal peptide:  MALSTRTQAACLLLLLLASLSSTTYL
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23; 10-13; 11-19; 14-22
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005568_AF2.pdbhor005568_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 325763 Formula: C114H178N32O36S8
Absent amino acids: AHLMTVWY Common amino acids: C
pI: 4.43 Basic residues: 2
Polar residues: 12 Hydrophobic residues: 5
Hydrophobicity: 21.2 Boman Index: -3313
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 46.8
Instability Index: 4210.4 Extinction Coefficient cystines: 500
Absorbance 280nm: 20.83

Literature

  • PubMed ID:  12729891
  • Title:  Comparative analysis of mouse hepcidin 1 and 2 genes: evidence for different patterns of expression and co-inducibility during iron overload.